PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05926.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 301aa    MW: 33217.9 Da    PI: 6.6836
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05926.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-0928602254
                             SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54
                              +yp+ +++  LAk++gLt +qV++WF N R +
  Rsa1.0_05926.1_g00001.1 28 RQYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 60
                             68*****************************88 PP

2BELL42.71.5e-141303261
                     BELL 32 tvissFeavaglgsakpYtslAlkaiSrhF 61
                             +vissFe++ag+gsak+YtslAlk+iSr++
  Rsa1.0_05926.1_g00001.1  1 MVISSFEQAAGIGSAKSYTSLALKTISRQY 30
                             79***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075261.3E-8130IPR006563POX domain
SMARTSM003893.4E-41468IPR001356Homeobox domain
PfamPF059201.8E-132560IPR008422Homeobox KN domain
Gene3DG3DSA:1.10.10.607.7E-192670IPR009057Homeodomain-like
SuperFamilySSF466892.14E-122871IPR009057Homeodomain-like
PROSITE profilePS5007110.772964IPR001356Homeobox domain
CDDcd000863.46E-102965No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MVISSFEQAA GIGSAKSYTS LALKTISRQY PKDSDKHMLA KQTGLTRSQV SNWFINARVR  60
LWKPMVEEMY AEEMKEQGKN MGSMEKTPNL DENIDDYASK STSNQEKIPM GGGGADNYHL  120
NPSHNDDLER VTGMQGSPKR LRTSNEEMMQ PINAGFSSNE KHTMKILEER QGIRADGGYP  180
FMGSFGQYQM DEMSRFNVAV SDQELLAQRF SGNNNGVSLT LGLPHCDSLS STHHQGFMQN  240
HHGIQIGRSV KIGETEEYGN SAINGGSGST ATTHSSAAAY NGMNIQNQKR YVAQLLPDFV  300
A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683591.11e-176PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_013629804.11e-176PREDICTED: BEL1-like homeodomain protein 1 isoform X1
SwissprotQ9SJ561e-147BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0D3B5561e-176A0A0D3B556_BRAOL; Uncharacterized protein
TrEMBLA0A078CR561e-175A0A078CR56_BRANA; BnaC03g19820D protein
STRINGBra023045.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2179422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-145BEL1-like homeodomain 1